PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008225443.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 417aa    MW: 45997.1 Da    PI: 7.8545
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008225443.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.6e-1857117257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  XP_008225443.1  57 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 117
                     89*****************99*************************************995 PP

2Wus_type_Homeobox1123.1e-3656118264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
     XP_008225443.1  56 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 118
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-745116IPR009057Homeodomain-like
PROSITE profilePS5007110.51153118IPR001356Homeobox domain
SuperFamilySSF466895.13E-1253120IPR009057Homeodomain-like
SMARTSM003896.8E-955122IPR001356Homeobox domain
CDDcd000861.24E-856118No hitNo description
PfamPF000462.3E-1557117IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPANCS THHQWQHDIN PSLVSNGCHR PSYSSVAGCE ERSPEPKPRW  60
NPKPEQIRIL EAIFNSGMVN PPRDEIRKIR AQLQEYGQVG DANVFYWFQN RKSRSKHKLR  120
HLHNSSKQQQ THHHTHLPPT TPVSTSTLNI INAAAPSSSS SSSEKSSPKS APNSKAFSMG  180
FSSNVAAHDV SINSPTASVN QQRSFFQPHH QHHSEILPEP FFFPMHPNPN CNFTQGFCFS  240
ELSNVVDVPN HGTHEQTNNN TGPCTSLLLS EIMSHGAAMS RKEYHQEDEM KVMNMKNMDP  300
HHLNYSLNVT TTSPTSHTNM VASRTTGPTT SVAVPSPMIH NIQGGVGEAG AMGAGGAEKS  360
TVFINDVAFE VGAGPFNVRE AFGDDAVLIH SSGHPVLTNE WGVTLHSLHH GAFYYLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008225443.10.0PREDICTED: WUSCHEL-related homeobox 9
TrEMBLM5X4I80.0M5X4I8_PRUPE; Uncharacterized protein
STRINGVIT_10s0003g00560.t011e-143(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.14e-64homeobox-3